defensin-like peptides |
Defensin-related cryptdin-4 |
shuchins |
||
This 52 amino acid antimicrobial peptide with a sequence resembling those of defensins (VTCELLMFGGVVGDSACAANCLSMGKAGGSCNGGLCDCRKTTFKELWDKRFG) has been isolated from the venoms of the ectoparasitic wasp, Nasonia vitripennis. Defensin-NV shows strong antimicrobial activity against Gram-positive bacteria, Gram-negative bacteria and fungi.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |