deformed epidermal autoregulatory factor-1 |
DEFT |
FAS ligand |
||
[defensin-related peptide-1] Defr1 (NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK) is one of the mouse beta-defensins. The protein has been isolated and characterized by Morrison et al (2002). Defr1 deviates from the canonical six cysteine motif present in the mature functional peptide of all other beta-Defensins, having only five of the canonical six cysteine residues. Its genomic organization is highly similar to defensin-beta-3, defensin-beta-4, defensin-beta-5, and defensin-beta-6. A synthetic Defr1 peptide displays antimicrobial activity against Staphylococcus aureus, Pseudomonas aeruginosa, Escherichia coli, and Burkholderia cepacia.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |