dendritic epidermal T-cells |
dendrocyte-expressed seven transmembrane protein |
NS5B protein |
||
abbr. DNP. This peptide identified originally in the venom of the Green Mamba (Dendroaspis angusticeps) (EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA) is structurally homologous to natriuretic peptides such as ANF [Atrial natriuretic factor; atrionatriuretic factor] and CNP [C-type natriuretic peptide] and has been shown to bind to the NPR1 [natriuretic peptide receptor 1; Atrial natriuretic peptide receptor 1] and the NPR3 atrial natriuretic peptide clearance receptor C (Schweitz et al, 1992) receptors. Singh et al (2006) have reported that Dendroaspis natriuretic peptide is selective for
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |