COPE Media Kit

Cope Home
Previous entry:
dendritic epidermal T-cells
Next entry:
dendrocyte-expressed seven transmembrane protein
Random entry:
NS5B protein
Search COPE:

Dendroaspis natriuretic peptide

abbr. DNP. This peptide identified originally in the venom of the Green Mamba (Dendroaspis angusticeps) (EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA) is structurally homologous to natriuretic peptides such as ANF [Atrial natriuretic factor; atrionatriuretic factor] and CNP [C-type natriuretic peptide] and has been shown to bind to the NPR1 [natriuretic peptide receptor 1; Atrial natriuretic peptide receptor 1] and the NPR3 atrial natriuretic peptide clearance receptor C (Schweitz et al, 1992) receptors. Singh et al (2006) have reported that Dendroaspis natriuretic peptide is selective for ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=14764