COPE Media Kit

Cope Home
Previous entry:
Diapause hormone
Next entry:
Diapause-specific peptide
Random entry:
Nod-like receptors
Search COPE:


abbr. DSP. Called also Diapause-specific peptide. Diapausin (AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN) has been identified in hemolymph of diapausing individuals of the leaf beetle, Gastrophysa atrocyanea (Tanaka et al, 2003). Silencing of diapausin expression does not affect diapause onset or maintenance, but the peptide blocks fungal growth (Tanaka and Suzuki, 2005). Diapausins have been identified also in some other insects, and a family of 14 homologous peptides has been described in Manduca sexta (He Y et al, 2015). These peptides are thought to protect insects from fungal infection during diapause and other prolonged stationary stages.

Diapausin inhibits N-type voltage-dependent Ca2+ channels and acts on chromaffin cells ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=15043