COPE Media Kit

Cope Home
Previous entry:
Drosophila melanogaster bithorax
Next entry:
Drosophila melanogaster Diptericin
Random entry:
RNA binding motif protein 5
Search COPE:

Drosophila melanogaster Defensin

This Drosophila melanogaster antimicrobial peptide (ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN), encoded by gene CG1385, shows sequence similarities with defensins from mammalian neutrophils and macrophages. Expression is induced by bacterial challenge with kinetics of an acute phase protein. The protein is expressed also in the absence of immune challenge during metamorphosis (Dimarcq et al, 1994).

Brennan et al (2007) have shown that induction of Defensin in the fat body during infection requires phagocytic blood cells for detecting infection and activating humoral immune responses. They have identified Psidin, encoded by gene ... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=15747