EBNA-5 |
ebnerin |
GGVTGVTEFEPVDVSGEDYDSDEMDEDGRA |
||
[Epstein-Barr virus nuclear antigen leader protein] This protein is encoded by Epstein-Barr virus and is one of the first proteins expressed upon virus infection of resting cells (Alfieri et al, 1991). The protein is known also as EBNA-5 [Epstein-Barr virus nuclear antigen-5].
The EBNA-LP protein contains a multi-repeat domain of repeated 22 and 44 amino acids and a carboxyterminal domain encoded by two unique exons (Speck et al, 1986). Multiple isoforms of the protein are generated during infection. either by alternative splicing or by varying the number of protein repeats (Dillner et al, 1986). The number of repeats varies depending on the EBV isolate or EBV-immortalized cell line.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |