COPE Media Kit


Cope Home
Previous entry:
EBNA-5
Next entry:
ebnerin
Random entry:
GGVTGVTEFEPVDVSGEDYDSDEMDEDGRA
Search COPE:

EBNA-LP

[Epstein-Barr virus nuclear antigen leader protein] This protein is encoded by Epstein-Barr virus and is one of the first proteins expressed upon virus infection of resting cells (Alfieri et al, 1991). The protein is known also as EBNA-5 [Epstein-Barr virus nuclear antigen-5].

The EBNA-LP protein contains a multi-repeat domain of repeated 22 and 44 amino acids and a carboxyterminal domain encoded by two unique exons (Speck et al, 1986). Multiple isoforms of the protein are generated during infection. either by alternative splicing or by varying the number of protein repeats (Dillner et al, 1986). The number of repeats varies depending on the EBV isolate or EBV-immortalized cell line.

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: December 2005



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=16150