enarkyochrome cells |
Enbocin2 |
Zinc finger homeobox protein 1a |
||
The cDNA encoding Enbocin has been cloned from a cDNA library prepared from immunized silkworm (Bombyx mori). Enbocin2, KPWNFFKEIERAVARTRDAVISAGPAVATVGAAAAVASG, and Enbocin3, KPWNFFKEIERAVARTRDAVISAGPAVATVAAASAVASG, are expressed specifically in the fat body. The two proteins may be allelic polymorphisms of Enbocin.
Recombinant Enbocin (PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS) has been shown to have a broad range of antibacterial activities against Gram-positive bacteria and Gram-negative bacteria (Kim et al, 1998). Tissue-specific expression of Enbocin is observed mainly in the fat body upon injection of Escherichia coli
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |