ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW |
Ese1 |
interferon-induced transmembrane protein 2 |
||
[Eriocheir sinensis double WAP domain containing protein] This protein of 111 amino acids from the Chinese mitten crab Eriocheir sinensis has been identified by Li F et al (2012). The protein contains two WAP domains (hence the designation DWD for double Wap domain). EsDWD is expressed ubiquitously. Expression of EsDWD in hemocytes is up-regulated after challenge by Vibrio anguillarum and Pichia pastoris GS115, as well as injury treatment. Purified recombinant EsDWD shows antimicrobial activities against Gram-negative bacteria and some yeasts and is thought to play a role in immune defenses and wound healing.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |