FCER2A |
Fc fragment of IgA receptor |
SEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG |
||
see: FCAMR [High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, Fc alpha/mu receptor].
In the nomenclature of CD antigens the receptor has been given the designation CD351.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |