Fibstatin |
Fibulin-3 |
VQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
||
abbr. FBLN1. Fibulin-1 is a calcium-binding secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix (Argraves et al, 1989). The mouse protein has been identified independently as BM-90 (Pan et al, 1993; Kluge et al, 1990).
Fibulin-1 is expressed in most tissues (Roark et al, 1995; Miosge et al, 1996; Zhang et al, 1996) and in a variety of cultured cells, including fibroblasts, smooth muscle cells, and several epithelial cell lines, but not endothelial cells, lymphomyloid cells, or a number of carcinoma and melanoma lines (Roark et al, 1995). Fibulin-1 expression in the brain is confined to neurons
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |