Gabelzellen |
GACLRSGRGCG |
VCVLAHHFGKEFTPPVQAAYQKWAGVANALAHRYH |
||
(approved gene symbol) [GABA-A receptor-beta-3; Gamma-aminobutyric acid receptor-beta-3] The cDNA has been cloned by Wagstaff et al (1991) and the gene structure has been reported by Glatt et al (1997) and Urak et al (2006). GABRB3 is a member of the GABA-A receptor gene family of heteromeric pentameric ligand-gated ion channels activated by Gamma-aminobutyric acid, the major inhibitory neurotransmitter in the mammalian brain.
Role in stem cell biology
GABRB3 has been used as a stem cell marker for human pluripotent stem cells (Inamdar et al, 2009), a pluripotency marker in blastomere single cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |