GFGSFLGKALKAALKIGANALGGSPQQ |
GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME |
immune-induced peptide 16 |
||
This peptide corresponds to CPF-5 [caerulein-precursor fragment 5] See: caerulein precursor-related fragments.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |