GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF |
GIS5 |
Locustatachykinin III |
||
This peptide, Gly-Ile-Arg-Leu-Arg-Gly, has been identified in a phage display screen as a peptide that selectively recognizes tumors responding to ionizing radiation. In irradiated glioma cells the glucose-regulated protein GRP78 has been identified as the receptor target for GIRLRG. Antibodies to GRP78 block the binding of GIRLRG in vitro and in vivo. Conjugation of GIRLRG to a sustained-release nanoparticle drug delivery system for paclitaxel causes cell death by apoptosis in irradiated breast carcinomas for up to 3 weeks. A single administration of the GIRLRG-targeted nanoparticles to irradiated tumors delays tumor progression.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |