GKRKKKGKLGKKRPRSR |
GKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKP |
C2ORF9 |
||
This bioactive peptide, GKSRIQRLNILNAKFAFNLYRVLKDQ, corresponds to the A domain of HCF2 [Heparin cofactor 2]. See: SERPIND1.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |