GNBP3 |
GNCP-1A |
Epstein-Barr virus BamHI-A rightward frame 1 |
||
[guinea pig neutrophil cationic peptide-1] a small cationic peptide, RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC, found in guinea pig neutrophils. It is identical with GPNP [guinea pig neutrophil peptide] and belongs to the family of Alpha-Defensins. The sequence shows high identity with another peptide, GNCP-2, which is encoded by a homologous but different gene.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |