GPNMB |
GPPAT |
CD325 |
||
[guinea pig neutrophil peptide] GPNP, referred to also as GNCP-1A [Neutrophil cationic peptide 1 type A] or Neutrophil cationic peptide 1, RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC, is a protein belonging to the defensins and has been purified from a granule-rich subcellular fraction of peritoneal exudate Guinea pig neutrophils. The protein is microbicidal for selected bacterial, fungal, and viral test organisms.
The peptide has been identified independently as Corticostatic peptide GP-CS1 from guinea pig bone marrow on the basis of its ability to inhibit the secretion of corticosterone by isolated rat adrenal cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |