GWGSIFKHGRHAAKHIGHAAVNHYLamide |
GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ |
RAC1 |
||
This designer antimicrobial peptide, GYNYAKKLANLAKKFANALW, has been shown to be active against a broad range of Gram-positive bacteria and Gram-negative bacteria and several Vibrio species (Chou et al, 2008). Chen et al (2012) have reported that GS-H1 has anticancer peptide activity. It induces cell death by apoptosis in hepatocellular carcinoma cell lines and inhibits progression and metastasis of transplanted tumor cells in nude mice. This is accompanied by activation of caspase-3, caspase-7 and caspase-9 and down-regulation of Hsp27
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |