glioma homing peptide |
glioma initiation cells |
virgin cells |
||
This peptide (IL13p [IL13 peptide, interleukin-13 peptide] (TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT) is derived from IL13 (Gao et al, 2013) and specifically targets IL13RA2 [IL13R-alpha-2], which acts as a decoy receptor and is restricted in its expression to tumors (Mintz et al, 2002). Gao et al (2013) have reported that Glioma-homing peptide acts as a cell-penetrating peptide that can specifically enhance the uptake of cargo by tumor cells. For other peptides that can be used also to target glioma cells see: Pep-1 peptide, gHo peptide.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |