HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV |
Hadrurin |
horny cells |
||
(approved gene symbol) [hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase beta subunit] This enzyme is in the beta subunit of a multienzsyme complex hat catalyzes the last three steps of the beta-oxidation cycle of long-chain fatty acids. The beta subunit, called also MTPB [mitochondrial trifunctional protein beta subunit], 3-ketoacyl-CoA thiolase (EC2.3.1.16), named also Acetyl-CoA acyltransferase or Beta-ketothiolase, or LCKT [long-chain 3-ketoacyl-CoA thiolase], catalyzes the formation of CoA and 3-oxoacyl-CoA from Acyl-CoA (Kamijo et al, 1994; Middleton, 1994; Uchida et al, 1992; Ushikubo et al, 1996).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |