HGH-V protein |
HGIVVGTCPLGYTRRGGFCFQDDDY |
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK |
||
[Hepatocyte growth inhibitory factor] This factor of 15-40 kDa is found in the conditioned medium of an HTLV-infected T-cell line (ATL-2) (Inamoto et al, 1991. It is not identical with ADF (Adult T-cell leukemia-derived factor), which is secreted also by this cell line.
HGI appears to be secreted also by other cell lines that also secrete ADF into the conditioned medium while it is not detected in the conditioned medium of cell lines producing little ADF. HGI inhibits the proliferation of primary rat hepatocytes caused by EGF.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |