HGR74 |
HGT |
KKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPY |
||
[Hepatocyte growth stimulating factor] This factor of 75 kDa is isolated from the livers of mice treated with carbon tetrachloride. This biochemically uncharacterized factor strongly stimulates DNA synthesis in cultured rat hepatocytes. It does not react with monoclonal or polyclonal antibodies directed against human HGF (hepatocyte growth factor).
Another biochemically uncharacterized factor of the same name (90-110 kDa by gel filtration) has been isolated as a heparin binding protein (see also: HBGF [heparin binding growth factors]) from normal calf serum. It stimulates
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |