Hybridoma growth factor |
Hybridoma/plasmacytoma growth factor |
AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK |
||
abbr. HP1 (a term with multiple meanings). This factor was identified originally as a T-cell derived lymphokine with growth factor activity for B-cell hybridomas and plasmacytomas (see: HPGF, PCT-GF).
Although there is virtually no similarity between the NH2-terminal region of HP1 and its human biological counterpart (26 kDa protein = IFN-beta-2 = BSF-2 (B-cell stimulating factor-2) = IL6), extensive amino acid similarities in the middle and COOH-terminal regions of these molecules suggest that murine HP1 is a homolog of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |