IFN-c |
IFN-delta-1 |
VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY |
||
[interferon-delta; Delta-Interferon] This type 1 interferon protein is co-expressed with IFN-gamma by the trophectoderm of the pig conceptus between day 12 and day 18 of gestation (Lefèvre et al, 1998). Pig IFN-delta is a protein 149 amino acids. The protein shows high antiviral activity on porcine cells and is inactive on human cells. IFN-delta has high antiproliferative activity, which is enhanced significantly in the presence of IFN-gamma. On pig cells IFN-delta binds to the same type I receptor as IFN-alpha.
The vaccinia virus encoded factor B18R
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |