LEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
LEAP-2 |
mitogen inducible nuclear orphan receptor |
||
[liver-expressed antimicrobial peptide] This human peptide of 25 amino acids has been described by Krause et al (2000). LEAP-1 has been identified in human blood ultrafiltrate. It is expressed predominantly in the liver, and, to a much lower extent, in the heart. LEAP-1 is active against Gram-positive Bacillus megaterium, Bacillus subtilis, Micrococcus luteus, Staphylococcus carnosus, and Gram-negative Neisseria cinerea. It is active also against the yeast Saccharomyces cerevisiae. Sequence analysis shows that the peptide is the same as Hepcidin.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |