leukocyte immunoglobulin-like receptor subfamily B member 7 |
Leukocyte inhibitory factor |
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
This biochemically uncharacterized factor of 45-60 kDa is called also PRF (PMNL recruiting factor). It is secreted by rabbit peritoneal macrophages and human macrophages following stimulation by bacterial endotoxins. In rabbits this factor induces the local infiltration of segmented neutrophil granulocytes at the site of intradermal injection The factor is not identical with IL1, TNF-alpha, GM-CSF and IL6.
A similar factor, called PRA (PMNL recruiting activity), is secreted also by the human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |