LVSSKPQAHGAPAPPSGSAPH |
LVTLAAHLPAEFTPAVHASLDKFLSVSTVLTSKYR |
ANGPTL5 |
||
[Litopenaeus vannamei survivin] This protein has been cloned by Leu et al (2012) from the Pacific white shrimp Litopenaeus vannamei. The protein contains one BIR domain and appears to be the shrimp counterpart of Survivin.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |