Magentosis |
MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK |
CMKBR1 |
||
[macrophage agglutination factor] A fibronectin related human lymphokine. The factor agglutinates monocytes and translocates monocytes and neutrophils through artificial extracellular matrices. MAggF-mediated translocation depends on interaction of the lymphokine amino-terminal heparin binding domain with cell surface heparin-like molecules, whereas agglutination involves interactions between the MAggF cell-binding domain and integrin fibronectin receptors recognizing the RGD sequence (Godfrey et al, 1989).
Godfrey et al (1989, 1990) have conluded that the factor is a cellular fibronectin, containing a number of epitopes in common with
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |