Mcp3 |
Mcp4 |
ATCDLLSGIGVQHSACALHCVFRGNRGGYCTGKGICVCRN |
||
[monocyte chemoattractant protein-3] called also monocyte chemotactic protein-3 or SCYA7. MCP-3 is encoded by the NC28 cDNA. MCP-3 is a member of the family of CC-Chemokines. The factor has been renamed CCL7. See also: SCY family of cytokines for a systematic nomenclature used previously.
The MCP-3 protein (97 amino acids) sequence shows 74 % identity with MCP-1 and 58 % homology with MCP-2. Secreted MCP-3 differs from MCP-1 in being N-glycosylated. The MCP-3 (SCYA7) gene maps to human chromosome 17 q11.2-q12 close to the erbB2 locus.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |