MG50 |
MG-160 |
GWFKKTFHKVSHAVKSGIHAGQRGCSALGF |
||
[Mitsugumin 53] The approved gene symbol for this protein is TRIM72 [tripartite motif containing 72]. The mouse and human genes have been cloned by Cai et al (2009) who reported expression only in cardiac and skeletal muscle where it localises to the sarcolemmal membrane and intracellular vesicles of mouse skeletal muscle.
Physiological activity or injury to skeletal or cardiac muscle can lead to the release of MG53 into the systemic circulation, which may then act in a paracrine
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base