Mesothelin variant 3 |
message amplification phenotyping |
APKWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG |
||
mesotocin is considered an evolutionary intermediate of oxytocin, found in lungfishes, amphibians, reptiles, birds and marsupials (Acher et al, 1995). It differs from oxytocin by a single amino acid and corresponds to Ile3-oxytocin. For a related hormone see also: Isotocin. Phe2-mesotocin is a mesotocin variant found in Australian lungfish, Neoceratodus forsteri (Hyodo et al, 1997).
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |