MODY8 |
MOIH |
TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ |
||
[Moen blood group antigens]
abbr. Moa, is a low-incidence erythrocyte antigen (Kornstadt and Brocteur, 1972). Jarolim et al (1998) have reported that ELO involves the mutation at position 656 Arg-->His of erythrocyte band 3 protein (CD233). This antigen, therefore, can be assigned to the Diego blood group system.
For other entries pertaining to hematopoiesis see also the Hematology Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |