NERP-2 |
NERP-4 |
FKFGSFIKRMWRSKLAKKLRAKGKELLRDYANRVLSPEEEAAAPAPVPA |
||
[Neuroendocrine regulatory peptide-3] NERP-3 (QQETAAAETETRTHTLTRVNLESPGPERVW with N terminal pyroglutamylation) is a biologically active peptide derived from the neurosecretory protein VGF. Rat NERP-3 corresponds to VGF(180-209). It is secreted by an endocrine cell line. NERP-3 is identified in acid extracts of rat brain and gut as a 30-residue NERP-3 with N-terminal pyroglutamylation. It is more abundant in the brain, including the posterior pituitary, than in the gut. Intracerebroventricular administration of NERP-3 in conscious rats induces Fos expression in a subset of neurons containing arginine-vasopressin. NERP-3 causes a significant release of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |