NFDEIDRSSFGFN |
NFHEV |
FFGVGGEEDITVQTVTWPDMELPLPRNITEGE |
||
This peptide corresponds to P18 peptide, a bioactive fragment of PEDF [pigment epithelium-derived factor].
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
See also: Angiogenesis Dictionary section of this encyclopedia for other entries directly bearing on factors and processes involved in the generation of new blood vessels.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |