NG29 |
NGAL |
GESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRG |
||
[neuroglandular antigen] NGA is an antigen overexpressed in melanoma tissues and cell lines, but it is found also in a variety of other tumors, as well as in normal cells. The antigen is detected by a panel of murine monoclonal antibodies of both IgG2a (LS62, LS76, LS159) and IgG1 (LS113, LS140, LS152) subclasses (Sikora et al, 1987). The name derives from the observation that canh be detected in both tissues of neural crest origin and glandular tissue from the salivary gland, prostate, breast, and respiratory tract. Demetrick et al (1992) have reported that this antigen is identical to CD63.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |