NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
N-ERC/mesothelin |
Met-chemokine-beta-7 |
||
[Neuropeptide Y receptor-like] This Drosophila melanogaster G-protein-coupled receptor, encoded by gene CG5811, has been identified by Li et al (1992). The receptor shares significant amino acid identity with mammalian tachykinin receptors and has been referred to by the authors as PR4 protein. When expressed in Xenopus laevis oocytes, the receptor is activated by mammalian neuropeptides in the order: peptide YY > neuropeptide Y >> pancreatic polypeptide. The receptor is expressed at equivalent levels in adult Drosophila
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |