COPE Media Kit


Cope Home
Previous entry:
PMEM
Next entry:
p-METB
Random entry:
QKNDTAFSCHFFEIYLSNCFNKEKYIKNYLQIM
Search COPE:

PMEPA1

[prostate androgen-induced RNA 1] This is known also as TMEPA1 [transmembrane prostate androgen-induced RNA 1].

This transmembrane protein (27.8 kDa; 252 amino acids) is encoded by an androgen-regulated gene, the cDNA of which has been isolated by Xu et al (2000) from a prostate cDNA library. Highest expression is found in the glandular epithelial cells of the prostate. High expression is observed also in the uterus. Rae et al (2001) have identified the same protein as STAG1 [solid tumor-associated gene 1], the expression of which is upregulated in renal cell carcinoma and stomach and rectal adenocarcinomas. These authors identified two transcripts that give rise to proteins of 36 kDa and 39 kDa.

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: September 2003



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=40928