PMEM |
p-METB |
QKNDTAFSCHFFEIYLSNCFNKEKYIKNYLQIM |
||
[prostate androgen-induced RNA 1] This is known also as TMEPA1 [transmembrane prostate androgen-induced RNA 1].
This transmembrane protein (27.8 kDa; 252 amino acids) is encoded by an androgen-regulated gene, the cDNA of which has been isolated by Xu et al (2000) from a prostate cDNA library. Highest expression is found in the glandular epithelial cells of the prostate. High expression is observed also in the uterus. Rae et al (2001) have identified the same protein as STAG1 [solid tumor-associated gene 1], the expression of which is upregulated in renal cell carcinoma and stomach and rectal adenocarcinomas. These authors identified two transcripts that give rise to proteins of 36 kDa and 39 kDa.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |