PARCS |
parenchymal cells |
C-C motif, ligand 2 inflammatory |
||
Pardaxin (GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE) is the ichthyotoxic component in the secretion of the Red Sea flatfish Pardachirus marmoratus (Shai et al, 1988). Pardaxin exhibits shark repellent properties, causing increased solute permeability of the gills (Primor et al, 1984).
Pardaxin acts as a channel-forming neurotoxin that induces neurotransmitter release at subcytotoxic concentrations by both calcium-dependent and calcium-independent mechanisms and causes cell death by necrosis at higher concentrations (Shai, 1994).
Pardaxin has been shown to possess high antibacterial activity. Its potency is comparable to that of other known native antibacterial peptides such as magainin, cecropins and dermaseptins
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |