COPE Media Kit


Cope Home
Previous entry:
PARCS
Next entry:
parenchymal cells
Random entry:
C-C motif, ligand 2 inflammatory
Search COPE:

Pardaxin

Pardaxin (GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE) is the ichthyotoxic component in the secretion of the Red Sea flatfish Pardachirus marmoratus (Shai et al, 1988). Pardaxin exhibits shark repellent properties, causing increased solute permeability of the gills (Primor et al, 1984).

Pardaxin acts as a channel-forming neurotoxin that induces neurotransmitter release at subcytotoxic concentrations by both calcium-dependent and calcium-independent mechanisms and causes cell death by necrosis at higher concentrations (Shai, 1994).

Pardaxin has been shown to possess high antibacterial activity. Its potency is comparable to that of other known native antibacterial peptides such as magainin, cecropins and dermaseptins ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2014



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=39180