prepro-VIP(81-122) |
preptin(1-8) |
TAX1BP1 |
||
This peptide hormone (DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL) has been isolated from secretory granules of cultured murine beta TC6-F7 pancreatic island Beta-cells. Preptin corresponds to Asp(69)-Leu(102) of the proform of IGF-2 E-domain (the C-terminal extension following the mature peptide sequence that is removed from the precursor) (Buchanan et al, 2001), which justifies its inclusion in the list of cryptides. Preptin, according to UniProt, corresponds to IGF2(93-126).
Preptin is co-secreted with insulin and amylin from pancreatic beta-cells. The hormone increases insulin secretion from glucose-stimulated beta TC6-F7 cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |