QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL |
QARLLLSGIVQQQNNLLRAI |
CD231 |
||
This antibacterial peptide, referred to also as QL17 peptide, has been isolated from Crocodylus siamensis hemoglobin hydrolysate (Lueangsakulthai J et al, 2017). The peptide causes membrane leakage, does not cause DNA damage, and impairs siderophore production and triggers the release of free ferric ions in the cytoplasm.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |