QVRKYCPKVGYCSSKCSKADVWSLSSDCKFYCCLPPGWK |
QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW |
CD134 |
||
for this bioactive fragment of sheep casein-kappa, which corresponds to casein-kappa(165-171) [kappa-casein(165-171)], see: Caseinomacropeptide.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |