TEVs |
TEWSACNVRCGRGWQKRSR |
Tenecin-4 |
||
[turtle egg-white protein] This peptide, QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK, from Red sea turtle (Caretta caretta) resembles vertebrate beta-Defensins in its three-dimensional structure and thus might be considered one of the ovodefensins. The protein shows strong antibacterial activity against Escherichia coli and Salmonella typhimurium and possesses significant antiviral activity against an enveloped rhabdovirus, Chandipura virus, which is an emerging human pathogen. The peptide also inhibits growth of vesicular stomatitis virus. TEWP is part of the innate immunity of this organism and replaces lysozyme in the egg.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |