TRCPDGQFCPVACCLDPGGASYSCCRPLLD |
TRDL-1-alpha |
Leukocyte-derived neutrophil chemotactic factor |
||
[TNF-related death ligand-1] TRDL-1-alpha has been identified through EST database searching, using TNF-alpha protein as the search query. The protein is identical in sequence to APRIL. TRDL-1-beta and TRDL-1-gamma are splice variants that differ from TRDL-1-alpha by the deletion of two small regions within the protein coding region (Kelly et al, 2000).
In vitro binding experiments demonstrate that TRDL-1-alpha coprecipitates FAS and HVEM, suggesting that TRDL-1-alpha is an alternate ligand for these receptors (Kelly et al, 2000).
In the nomenclature of CD antigens
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |