VGlut3 amacrine cells |
VGMAPG |
BMZ |
||
This peptide with the sequence VSCNGVCSPFEMPPCGSSACRCIPYGLVVGNCRHPSG has been isolated from germinating pea seed extracts of peas (Pisum sativum).
Jiang H et al (2015) have reported that Vglycin promotes the proliferation of pancreatic Beta-cells and suppresses apoptosis and dedifferentiation of these cells. It promotes the restoration of Beta-cells in both young streptozotocin-induced type 1 diabetic SD rats and in aged high-fat diet with (or without) stretozotocin-induced type 2 diabetic C57BL/6 mice. This is accompanied by activating the insulin receptor and corresponding transcription factors. Impaired insulin sensitivity and glucose tolerance in aged T2DM mice
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |