Y134R |
YAAWPASGAWTGTAPCSAGT |
RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI |
||
[Yaba-like disease virus Y136 protein] Y136 is a secreted glycoprotein encoded by Yaba-like disease virus (YLDV), a yatapoxvirus. The protein is related to protein B18R from Vaccinia virus, sharing 27 % amino acid identity (Lee et al, 2001). Y136 inhibits both type 1 interferons (IFN-alpha, IFN-beta), and type 3 interferons (IL28A (IFN-lambda-2), IL28B (IFN-lambda-3), and IL29 (IFN-lambda-1)). Y136 inhibits IFN-induced signaling and suppresses IFN-mediated biological activities including upregulation of MHC class I antigen expression and induction of the antiviral state. Y136 is unable to inhibit mouse
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |