YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG |
YLDV 7L protein |
serpin peptidase inhibitor clade A member 10 |
||
This peptide corresponds to alpha-s1-casein(104-109).
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |