ZMDA1 |
ZMIZ3 |
GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW |
||
[Zea mays insulin-like growth factor] ZmIGF is a peptide of 5.7 kDa isolated from maize tissues. ZmIGF seems to perform, in maize, a similar function to that reported for insulin or peptides from the IGF family in animals and regulates growth and cell division in maize tissues (Rodríguez-López CD et al, 2011).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |