adipokinetic hormone precursor related peptides |
adipolin |
GVFDIIKGAGKQLIAHAMEKIAEKVGLNKDGN |
||
This name occurs in company catalogues but not in public databanks such as PubMed as an alternative designation for adipocyte complement related protein of 30 kDa (Acrp30).
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |