agglutinin-like sequence 8 |
Aggrecanase-1 |
FIHHIIGGLFSVGKHIHSLIHGH |
||
This peptide (human 32mer peptide: FFGVGGEEDITVQTVTWPDMELPLPRNITEGE) is derived from aggrecan, the large proteoglycan that, together with collagen type 2, confers the weight-bearing properties of cartilage. It is generated in vivo by proteolytic cleavage within the aggrecan interglobular domain. The peptide shows anti-anabolic, pro-catabolic and pro-inflammatory bioactivity in vitro in mouse chondrocytes, synovial fibroblasts, and macrophages or cartilage explants (upregulation of MMP-12, MMP-13, ADAMTS5, MMP-14, MMP-8,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |