defensin-beta-42 |
defensin-beta 103A |
RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
[Beta-Defensin-103] gene symbol: CBD103. Defensin-beta-103 is a member of the beta-Defensins, a protein family implicated in innate immunity. Defensin-beta-103 has been shown to be expressed by epithelial cells in the respiratory tract and in skin and to have antimicrobial activity against the respiratory pathogen Bordetella bronchiseptica (Erles and Brownlie, 2010). Some studies have reported altered expression levels of Defensin-beta-3 in association with atopic dermatitis, but further investigation of the clinical significance is required (Santoro et al, 2013; Leonard et al, 2012; van Damme et al, 2009).
The defensin-beta-103 gene is known also as K locus in dogs
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |