demilune cells |
dendritic cell and monocyte chemokine-like protein |
GKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKP |
||
abbr. DEF (a term with multiple meanings). This biochemically uncharacterized factor of 30-100 kDa has been identified by Suzuki et al (1993). The activity is found in the conditioned medium of macrophages in response to UV irradiation and induces the extension of dendrites of melanocyte.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |